The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
55
|
sequence length |
168
|
structure length |
164
|
Chain Sequence |
MSEHRERISMINPRVVLDENGISHRSRYFIMLCDNETAIAHAKKTSIWAVKKDSSKRISDAYKKASVYFIFVAQQTYNALGYAQVVSDLNSTELPFWSDSSHAGGVRIKWIKTCNLFSAEISEIVSHMDHGSEARDGMEMMYDEGSRLCTLINYAIMKRIGRDR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
A novel RNA-binding mode of the YTH domain reveals the mechanism for recognition of determinant of selective removal by Mmi1
pubmed doi rcsb |
| molecule tags |
Rna binding protein/rna
|
| source organism |
Schizosaccharomyces pombe 972h-
|
| molecule keywords |
YTH domain-containing protein mmi1
|
| total genus |
55
|
| structure length |
164
|
| sequence length |
168
|
| ec nomenclature | |
| pdb deposition date | 2015-09-10 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF04146 | YTH | YT521-B-like domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Roll | ph1033 like fold | ph1033 like domains |
#chains in the Genus database with same CATH superfamily 2ZBN A; 1ZCE A; 4RCI A; 2GBS A; 1WMM A; 2HD9 A; 5DNO A; 5J3E A; 2AR1 A; 2EVE A; 3EOP A; 4RCM A; 2YU6 A; 4RCJ A; 4RDO A; 2G2X A; 2P5D A; 2YUD A; 4RDN A; 4U8T A; 4WQN A; #chains in the Genus database with same CATH topology 2ZBN A; 1ZCE A; 4RCI A; 2GBS A; 1WMM A; 2HD9 A; 5DNO A; 5J3E A; 2AR1 A; 2EVE A; 3EOP A; 4RCM A; 2YU6 A; 4RCJ A; 4RDO A; 2G2X A; 2P5D A; 2YUD A; 4RDN A; 4U8T A; 4WQN A; #chains in the Genus database with same CATH homology 2ZBN A; 1ZCE A; 4RCI A; 2GBS A; 1WMM A; 2HD9 A; 5DNO A; 5J3E A; 2AR1 A; 2EVE A; 3EOP A; 4RCM A; 2YU6 A; 4RCJ A; 4RDO A; 2G2X A; 2P5D A; 2YUD A; 4RDN A; 4U8T A; 4WQN A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
