The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
20
|
sequence length |
91
|
structure length |
83
|
Chain Sequence |
ANKQDLIAKVAEATELTKKDSAAAVDAVFSAVSSYLAKGEKVQLIGFGNFEVRERAARKEIKIKASKVPAFKAGKALKDAVKH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Dna binding protein
|
source organism |
Streptococcus mutans serotype c (strain atcc 700610 / ua159)
|
publication title |
Crystal structure of histone-like protein from Streptococcus mutans refined to 1.9 angstrom resolution.
pubmed doi rcsb |
molecule keywords |
DNA-binding protein HU
|
total genus |
20
|
structure length |
83
|
sequence length |
91
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2015-12-14 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00216 | Bac_DNA_binding | Bacterial DNA-binding protein |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Few Secondary Structures | Irregular | HU Protein; Chain A | IHF-like DNA-binding proteins |
#chains in the Genus database with same CATH superfamily 4YEX A; 1EXE A; 2O97 A; 2O97 B; 4FMR A; 4YEY A; 4DKY A; 2NP2 A; 1IHF A; 1IHF B; 4N1V A; 4QJN A; 4YFT C; 4YF0 A; 5L8Z A; 3RHI A; 1OUZ A; 1OWG A; 4YEW A; 1OUZ B; 1OWF A; 1WTU A; 1OWF B; 1OWG B; 5FBM A; 2IIF A; 1MUL A; 1HUU A; 4PT4 A; 2IIE A; 1P78 A; 1RIY A; 4P3V A; 4QJU A; 2HT0 B; 2HT0 A; 1HUE A; 4YFT A; 1B8Z A; 5EKA A; 1P51 A; 1P71 A; 2NDP A; 4YFH A; 4YEW C; #chains in the Genus database with same CATH topology 4YEX A; 1EXE A; 2O97 A; 2O97 B; 4FMR A; 4YEY A; 4DKY A; 2NP2 A; 1IHF A; 1IHF B; 4N1V A; 4QJN A; 4YFT C; 4YF0 A; 5L8Z A; 3RHI A; 1OUZ A; 1OWG A; 4YEW A; 1OUZ B; 1OWF A; 1WTU A; 1OWF B; 1OWG B; 5FBM A; 2IIF A; 1MUL A; 1HUU A; 4PT4 A; 2IIE A; 1P78 A; 1RIY A; 4P3V A; 4QJU A; 2HT0 B; 2HT0 A; 1HUE A; 4YFT A; 1B8Z A; 5EKA A; 1P51 A; 1P71 A; 2NDP A; 4YFH A; 4YEW C; #chains in the Genus database with same CATH homology 4YEX A; 1EXE A; 2O97 A; 2O97 B; 4FMR A; 4YEY A; 4DKY A; 2NP2 A; 1IHF A; 1IHF B; 4N1V A; 4QJN A; 4YFT C; 4YF0 A; 5L8Z A; 3RHI A; 1OUZ A; 1OWG A; 4YEW A; 1OUZ B; 1OWF A; 1WTU A; 1OWF B; 1OWG B; 5FBM A; 2IIF A; 1MUL A; 1HUU A; 4PT4 A; 2IIE A; 1P78 A; 1RIY A; 4P3V A; 4QJU A; 2HT0 B; 2HT0 A; 1HUE A; 4YFT A; 1B8Z A; 5EKA A; 1P51 A; 1P71 A; 2NDP A; 4YFH A; 4YEW C;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...