The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
31
|
sequence length |
139
|
structure length |
139
|
Chain Sequence |
PHMGAYWMSPTADDIRAMNRMQRQRVVGFTVGRENVGSVQFKVPVDLSNINLDDLFGTIVILEPRSATVYPNAAKKPPMGKGLNVPALISLEHSWPRGGPTIKGRRLERHIERLKSIPDTTFESYDPETGVWAFSVEHF
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Architecture of the symmetric core of the nuclear pore.
pubmed doi rcsb |
| molecule tags |
Transport protein
|
| source organism |
Chaetomium thermophilum (strain dsm 1495 / cbs 144.50 / imi 039719)
|
| molecule keywords |
Nucleoporin NUP145
|
| total genus |
31
|
| structure length |
139
|
| sequence length |
139
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
3.4.21.-: |
| pdb deposition date | 2015-12-31 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | c-terminal autoproteolytic domain of nucleoporin nup98 | Peptidase S59, nucleoporin |
#chains in the Genus database with same CATH superfamily 3KEP A; 5HB6 A; 2Q5Y A; 2Q5X A; 5CWW A; 2AIV A; 5E0Q B; 3KES A; 3PBP B; 3NF5 A; 3TKN C; 1KO6 A; 5HB5 A; #chains in the Genus database with same CATH topology 3KEP A; 5HB6 A; 2Q5Y A; 5HB5 A; 2Q5X A; 5CWW A; 4DRF B; 2AIV A; 5E0Q B; 3KES A; 3PBP B; 3NF5 A; 3TKN C; 1KO6 A; 4DQZ A; 4E6N B; #chains in the Genus database with same CATH homology 3KEP A; 5HB6 A; 2Q5Y A; 2Q5X A; 5CWW A; 2AIV A; 5E0Q B; 3KES A; 3PBP B; 3NF5 A; 3TKN C; 1KO6 A; 5HB5 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
