The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
65
|
sequence length |
166
|
structure length |
166
|
Chain Sequence |
SSIKKISFVGIFSALATLVMFLEFPIFPQASFLKYDPSEIPALIVSFLLGPGVGMFVVLVKDILFFLMKSGDPVGIAMNAVLGMSFVGIAGLIYHRNKSRATAIKGMIVATLFATAFALGLNALIVPLYFEAPFELYLKFFPFILAFNLVKFGIDSVVTFFVYKKV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
An Aromatic Cap Seals the Substrate Binding Site in an ECF-Type S Subunit for Riboflavin.
pubmed doi rcsb |
| molecule tags |
Transport protein/membrane protein
|
| source organism |
Thermotoga maritima (strain atcc 43589 / msb8 / dsm 3109 / jcm 10099)
|
| molecule keywords |
Riboflavin transporter RibU
|
| total genus |
65
|
| structure length |
166
|
| sequence length |
166
|
| ec nomenclature | |
| pdb deposition date | 2016-06-03 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF12822 | ECF_trnsprt | ECF transporter, substrate-specific component |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Arp2/3 complex 21 kDa subunit ARPC3 | Arp2/3 complex 21 kDa subunit ARPC3 |
#chains in the Genus database with same CATH superfamily 5D0Y A; 5D3M C; 4TKR A; 5KC0 A; 4HUQ S; 4POP A; 4M5C A; 4HZU S; 5JSZ C; 5KBW A; 3P5N A; 4RFS S; 4Z7F A; 4N4D A; 5KC4 A; 4MHW A; 4DVE A; 4MES A; 4POV A; 4M5B A; 3RLB A; 4MUU A; 4M58 A; #chains in the Genus database with same CATH topology 5D0Y A; 5D3M C; 4TKR A; 3ULE E; 3DXK E; 2P9U E; 5KC0 A; 4HUQ S; 2P9S E; 3RSE E; 4POP A; 3UKR E; 4JD2 E; 4HZU S; 4M5C A; 4MUU A; 5JSZ C; 5KBW A; 3P5N A; 2P9K E; 4RFS S; 4XEI E; 4Z7F A; 4N4D A; 5KC4 A; 1U2V E; 1TYQ E; 2P9N E; 4MHW A; 3DXM E; 2P9L E; 4DVE A; 4MES A; 4POV A; 3UKU E; 4M5B A; 3RLB A; 2P9I E; 2P9P E; 1K8K E; 4M58 A; #chains in the Genus database with same CATH homology 5D0Y A; 5D3M C; 4TKR A; 5KC0 A; 4HUQ S; 4POP A; 4M5C A; 4HZU S; 5JSZ C; 5KBW A; 3P5N A; 4RFS S; 4Z7F A; 4N4D A; 5KC4 A; 4MHW A; 4DVE A; 4MES A; 4POV A; 4M5B A; 3RLB A; 4MUU A; 4M58 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
