The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
35
|
sequence length |
175
|
structure length |
175
|
Chain Sequence |
SEPQRLFFAIDLPAEIREQIIHWRAKHFPPEAGRPVAADNLHLTLAFLGEVSAEKEKALSLLAGRIRQPGFTLTLDDAGQWLRSRVVWLGMRQPPRGLIQLANMLRSQAARSGCFQSNRPFHPHITLLRDASEAVTIPPPGFNWSYAVTEFTLYASSFARGRTRYTPLKRWALTQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural aspects of nucleotide ligand binding by a bacterial 2H phosphoesterase.
pubmed doi rcsb |
molecule tags |
Hydrolase
|
source organism |
Escherichia coli bl21(de3)
|
molecule keywords |
RNA 2',3'-cyclic phosphodiesterase
|
total genus |
35
|
structure length |
175
|
sequence length |
175
|
chains with identical sequence |
B, C, D
|
ec nomenclature |
ec
3.1.4.-: |
pdb deposition date | 2016-06-27 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02834 | LigT_PEase | LigT like Phosphoesterase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Alpha-Beta Complex | Cyclic Phosphodiesterase; Chain: A, | Cyclic phosphodiesterase |
#chains in the Genus database with same CATH superfamily 5LDJ A; 5LDP A; 5LDK A; 1VGJ A; 2VFK A; 1FSI A; 5LDI A; 4QAK A; 5LDM A; 2FYH A; 5LDQ A; 1JH7 A; 4H7W A; 2VFL A; 1IUH A; 2D4G A; 2FSQ A; 1VDX A; 5JJ2 A; 5LDO A; 1JH6 A; 2VFY A; #chains in the Genus database with same CATH topology 5LDJ A; 5LDP A; 5LDK A; 1VGJ A; 2VFK A; 1FSI A; 5LDI A; 4QAK A; 5LDM A; 2FYH A; 5LDQ A; 1JH7 A; 4H7W A; 2VFL A; 1IUH A; 2D4G A; 2FSQ A; 1VDX A; 5JJ2 A; 5LDO A; 1JH6 A; 2VFY A; #chains in the Genus database with same CATH homology 5LDJ A; 5LDP A; 5LDK A; 1VGJ A; 2VFK A; 1FSI A; 5LDI A; 4QAK A; 5LDM A; 2FYH A; 5LDQ A; 1JH7 A; 4H7W A; 2VFL A; 1IUH A; 2D4G A; 2FSQ A; 1VDX A; 5JJ2 A; 5LDO A; 1JH6 A; 2VFY A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...