5LTUA

Crystal structure of nudt4a- diphosphoinositol polyphosphate phosphohydrolase 2
Total Genus 34

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
138
structure length
127
Chain Sequence
TRTYDREGFKKRAACLCFRSEQEDEVLLVSSPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFENQDRKHRTYVYVLTVTEILEGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLG

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTIV1 (38-44)TI1 (13-16)S2 (33-38)TI4 (86-89)AH1 (59-71)S1 (18-26)AH2 (122-132)S7 (117-121)TI3 (54-57)S3 (46-47)S4 (50-52)TI5 (87-90)S6 (91-103)TI2 (28-31)S5 (73-86)Updating...
connected with : NaN
molecule tags Hydrolase
source organism Homo sapiens
publication title Crystal Structure of Human NUDT4A- Diphosphoinositol polyphosphate phosphohydrolase 2
rcsb
molecule keywords Diphosphoinositol polyphosphate phosphohydrolase 2
total genus 34
structure length 127
sequence length 138
chains with identical sequence B
ec nomenclature ec 3.6.1.52: Diphosphoinositol-polyphosphate diphosphatase.
pdb deposition date 2016-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.