5MQTA

Crystal structure of dck mutant c3s in complex with imatinib and udp
Total Genus 81

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
241
structure length
230
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNTMSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH6 (149-166)EMPTYS1 (22-27)TII1 (29-32)AH1 (34-44)AH3 (73-87)AH2 (54-59)TI2 (88-91)3H1 (196-199)AH4 (92-113)AH5 (130-144)TIV3 (116-119)S3 (123-127)AH7 (182-192)TVIII1 (145-148)TI4 (167-170)S4 (174-179)TI5 (168-171)3H2 (226-229)S2 (48-51)TIV5 (126-129)TIV2 (115-118)TIV4 (119-122)AH8 (202-217)TVIII2 (223-226)TI1 (45-48)TIV1 (114-117)Updating...
connected with : NaN
molecule tags Transferase
source organism Homo sapiens
publication title Dual protein kinase and nucleoside kinase modulators for rationally designed polypharmacology.
pubmed doi rcsb
molecule keywords Deoxycytidine kinase
total genus 81
structure length 230
sequence length 241
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2016-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.