5R4PA

Pandda analysis group deposition -- crystal structure of human cleavage factor im in complex with nm450-1
Total Genus 54
2040608010012014016018001020304050
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
197
structure length
197
Chain Sequence
SMLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
S1 (36-39)S3 (77-88)3H1 (42-44)EMPTYS10 (191-197)TVIII1 (55-58)AH1 (60-74)TIV4 (165-168)TIV3 (158-161)S7 (140-150)S4 (91-99)TIV2 (98-101)S6 (108-110)S5 (104-105)TI1 (131-134)S8 (170-178)S9 (183-188)TI2 (188-191)TII1 (112-115)TII2 (162-165)TIV1 (87-90)AH2 (117-129)S2 (45-50)TVIII2 (180-183)Updating...
connected with : NaN
publication title PanDDA analysis group deposition
rcsb
molecule keywords Cleavage and polyadenylation specificity factor subunit 5
molecule tags Rna binding protein
source organism Homo sapiens
total genus 54
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2020-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13869 NUDIX_2 Nucleotide hydrolase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.