5U7FA

Co-bound dihydroneopterin triphosphate pyrophosphohydrolase from e. coli
Total Genus 41
204060801001201400510152025303540
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
144
structure length
144
Chain Sequence
VYKRPVSILVVIYAQDTKRVLMLQRRDDPDFWQSVTGSVEEGETAPQAAMREVKEEVTIDVVAEQLTLIDCQRTVEFEIFSHLRHRYAPGVTRNTESWFCLALPHERQIVFTEHLAYKWLDAPAAAALTKSWSNRQAIEQFVIN

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYS3 (36-37)S1 (10-18)TI4 (32-35)S6 (97-107)TI1 (18-21)S7 (118-124)TI2 (19-22)S2 (24-29)TVIII1 (30-33)S5 (72-82)AH2 (126-132)TI3 (29-32)TII1 (44-47)TIV1 (64-67)TI6 (66-69)O1 (75-104)AH3 (136-146)3H1 (85-90)TIV2 (115-118)AH1 (49-61)S4 (39-42)TII2 (92-95)Updating...
connected with : NaN
molecule tags Hydrolase
source organism Escherichia coli o157:h7
publication title Metal ion coordination in the E. coli Nudix hydrolase dihydroneopterin triphosphate pyrophosphatase: New clues into catalytic mechanism.
pubmed doi rcsb
molecule keywords Dihydroneopterin triphosphate diphosphatase
total genus 41
structure length 144
sequence length 144
ec nomenclature ec 3.6.1.67: Dihydroneopterin triphosphate diphosphatase.
pdb deposition date 2016-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.