5Z78A

Structure of tirr/53bp1 complex
Total Genus 57
204060801001201401601800102030405060
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
200
structure length
199
Chain Sequence
MVPELKQISREEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGLLGFPGGFVDRRFWSLEDGLNRVLGLGGGLRLTEADYLSSHLTEGPHRVVAHLYARQLTLEQLHAVEISAVHSRDHGLEVLGLVRVPLYTQKDRVGGFPNFLSNAFVSTAKYQLLFALKVLNMMPSEKLAEALASATEKQKKALE

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYS1 (10-12)TI3 (68-71)AH1 (14-19)S7 (64-67)TI1 (21-24)S6 (60-61)S2 (25-35)TIV1 (104-107)O1 (46-48)3H1 (41-42)S4 (44-45)S10 (139-145)S5 (48-55)TIV2 (135-138)TI2 (55-58)TII1 (134-137)TI4 (69-72)S9 (108-117)AH2 (74-81)AH3 (119-131)AH6 (185-203)TIV4 (152-155)TI6 (150-153)S8 (96-101)3H2 (93-95)S3 (39-40)TI5 (132-135)AH4 (157-162)AH5 (167-180)TVIII2 (181-184)Updating...
connected with : NaN
molecule tags Transcription/protein binding
source organism Mus musculus
publication title Structural basis for recognition of 53BP1 tandem Tudor domain by TIRR
pubmed doi rcsb
molecule keywords Tudor-interacting repair regulator protein
total genus 57
structure length 199
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2018-01-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.