5ZCJA

Crystal structure of complex
Total Genus 63
204060801001201401601800102030405060
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
199
structure length
199
Chain Sequence
VPELKQISRVEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGLLGFPGGFVDRRFWSLEDGLNRVLGLGLGCLRLTEADYLSSHLTEGPHRVVAHLYARQLTLEQLHAVEISAVHSRDHGLEVLGLVRVPLYTQKDRVGGFPNFLSNAFVSTAKCQLLFALKVLNMMPEEKLVEALAAATEKQKKALE
2040608010012014016018015010050
0102030405060Genus Matrix

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYS1 (10-11)AH1 (14-19)TI1 (21-24)S6 (60-61)TI3 (69-72)TI2 (55-58)S9 (108-116)S2 (25-35)O1 (46-48)S3 (39-40)3H1 (41-42)AH5 (167-180)S10 (139-145)S4 (44-45)TIV1 (135-138)S5 (48-55)TII1 (134-137)AH3 (119-131)TIV3 (152-155)TI5 (150-153)S8 (96-101)3H2 (93-95)S7 (64-67)TVIII1 (104-107)TI4 (132-135)AH4 (157-162)AH2 (74-86)AH6 (185-203)TVIII3 (181-184)Updating...
connected with : NaN
molecule tags Protein binding
source organism Homo sapiens
publication title Crystal structure of complex
rcsb
molecule keywords Tudor-interacting repair regulator protein
total genus 63
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2018-02-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.