5EE7A

Crystal structure of the human glucagon receptor (gcgr) in complex with the antagonist mk-0893
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
438
structure length
416
Chain Sequence
YSSFQVMYTVGYSLSLAALLLALAILGGLSKLHCTANAIHANLFLSFVLKASAVLFIDGLLRTVSTWLSDGAVAACRVAAVFMQYGIVANYCWLLVEGLYLHNLLGLNIFEMLRIDEGLRLKIYKDYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYPERSFFSLYLGIGWGAPALFVVPWAVVKCLFENVQCWTNMGFWWILRFPVFLAILINFFIFVRIVQLLVAKLRARQMHHTDYAFRLAKSTLTLIPLLGVHFVVFAFVTDEHRSAKLFFDLALSSFQGLLVAVLYCFLNKEVQSELRRRWHRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Extra-helical binding site of a glucagon receptor antagonist.
pubmed doi rcsb
molecule tags Signaling protein
source organism Homo sapiens
molecule keywords Glucagon receptor,Endolysin,Glucagon receptor
total genus 164
structure length 416
sequence length 438
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2015-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00959 Phage_lysozyme Phage lysozyme
A PF00002 7tm_2 7 transmembrane receptor (Secretin family)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...