5FQ1A

Structure of the cytoplasmic pas domain of the geobacillus thermodenitrificans histidine kinase cita
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
110
structure length
110
Chain Sequence
SPEEIGLLYQEKQAILEAIREGIVAINQEGTITMVNQTALKLLGYDNERNVLGTPILQLIPHSRLPEVIRTGQAEYDDEMVLGGETVIANRIPIKNKQGRVIGAVSTFRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cryogenic optical localization provides 3D protein structure data with Angstrom resolution.
pubmed doi rcsb
molecule keywords HISTIDINE KINASE
molecule tags Transferase
source organism Geobacillus thermodenitrificans
total genus 26
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2015-12-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...