5FT0A

Crystal structure of gp37(dip) from bacteriophage phikz
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
255
structure length
255
Chain Sequence
TQFNITWEEQLQALSKLDGLHHPHKLEDISVHWVFNPVDISVFVTCATMSSHNTHYTFKPQSSPDDAMVREYVLSRIIADNLKYVDNLYLAAGAVICGNDEYISDGNVVGIHIADGVGGNKLILPVIEFMPGVHVDDISDKLIKSSSYQGIFKTDNLEEFEFLVDKKNANNVKELILAYTDYFANKLAFKDPAEPAVEMYQFIDRTEVYFSFEGCHPDVEEVLFTIKIVRYNQPLNSTAMQVFLKNPLLSHIRTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords GP37
publication title Structural elucidation of a novel mechanism for the bacteriophage-based inhibition of the RNA degradosome.
pubmed doi rcsb
source organism Pseudomonas phage phikz
total genus 63
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17679 Dip gp37/Dip protein
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...