5H1AA

Crystal structure of an iclr homolog from microbacterium sp. strain hm58-2
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
243
structure length
238
Chain Sequence
DSMLARVVRVLETFNVDRTAQTASDIGRRAALPSSTAHRVVDEMVLVGILERGIDGKVRLGMRLWELALRGSMALRLRQVALPHMERVQQRVREHTQLAVLEHNEVLFLERLSHHEAVSNLALPVHASSSGLMLLAHAGPEVREEVLSKPLPRVGPGTVTDPEALRRLLANAYRAGYVAAPGYIEAVATGIAVPIRSEGVVIAALSAVQPLQNAVEPTVEILREAAVGIETDLRASRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an IclR homologue from Microbacterium sp. strain HM58-2.
pubmed doi rcsb
molecule tags Transcription regulator
source organism Microbacterium sp.
molecule keywords IclR transcription factor homolog
total genus 70
structure length 238
sequence length 243
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01614 IclR Bacterial transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...