5HOUA

Solution structure of p53tad-taz1
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
171
structure length
171
Chain Sequence
GSHMEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDGSCFNGTATGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCTRHDCPVCLPLKNASDKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Recognition of the disordered p53 transactivation domain by the transcriptional adapter zinc finger domains of CREB-binding protein.
pubmed doi rcsb
molecule tags Transcription
source organism Homo sapiens
molecule keywords Cellular tumor antigen p53,CREB-binding protein fusion prote
total genus 49
structure length 171
sequence length 171
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08563 P53_TAD P53 transactivation motif
A PF18521 TAD2 Transactivation domain 2
A PF02135 zf-TAZ TAZ zinc finger
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...