5ICAD

Structure of the ctd complex of utp12, utp13, utp1 and utp21
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
119
structure length
119
Chain Sequence
DYLKALVMAFRLNEAGLITRVYQAIPYTDIGLVVEQFPTVYVPRLLRFVAAQTEQSPHMEFCLLWIRALIDKHGPWLAANRGKVDVELRVVARAVAKMRDEIRRLADENVYMVDYLLNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Integrative structural analysis of the UTPB complex, an early assembly factor for eukaryotic small ribosomal subunits
pubmed doi rcsb
molecule keywords Putative uncharacterized protein
molecule tags Structural protein
source organism Chaetomium thermophilum (strain dsm 1495 / cbs 144.50 / imi 039719)
total genus 36
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2016-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF04003 Utp12 Dip2/Utp12 Family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...