5J2SA

Nkr-p1b from rattus norvegicus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
122
structure length
121
Chain Sequence
KCPKDWHSHQDKCFHVSQTSITWKGSLADCGGKGATLLLVQDQEELRFLRNLTKRISSSFWIGLSYTLSDEKWKWINGSTLNSDALNITGDTEKDSCASVSQDKVLSESCDSDNIWICQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of NKR-P1B from Rattus norvegicus
rcsb
molecule keywords Killer cell lectin-like receptor subfamily B member 1B allel
molecule tags Immune system
source organism Rattus norvegicus
total genus 33
structure length 121
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00059 Lectin_C Lectin C-type domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...