5JW9A

The crystal structure of ell2 oclludin domain and aff4 peptide
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
36
structure length
36
Chain Sequence
SCVDEILKEMTHSWPPPLTAIHTPCKTEPSKFPFPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for ELL2 and AFF4 activation of HIV-1 proviral transcription.
pubmed doi rcsb
molecule tags Protein binding
source organism Homo sapiens
molecule keywords AF4/FMR2 family member 4
total genus 3
structure length 36
sequence length 36
ec nomenclature
pdb deposition date 2016-05-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...