5JWRE

Crystal structure of foldswitch-stabilized kaib in complex with the n-terminal ci domain of kaic and a dimer of kaia c-terminal domains from thermosynechococcus elongatus
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
132
structure length
132
Chain Sequence
DPQHRLSQKLKERLGYLGVYYKRDTAFFFRRMSPADKRKLLDELRSIYRTIVLEYFNTDAKVNERIDEFVSKAFFADISVSQVLEIHVELMDTFSKQLKLEGRSEDILLDYRLTLIDVIAHLSEMYRRSIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of the day-night transition in a bacterial circadian clock.
pubmed doi rcsb
molecule keywords Circadian clock protein kinase KaiC
molecule tags Transcription regulator
source organism Thermosynechococcus elongatus
total genus 53
structure length 132
sequence length 132
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2016-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07688 KaiA KaiA C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...