5KNMD

Human leukocyte antigen f (hla-f) presents peptides and regulates immunity through interactions with nk-cell receptors
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
195
structure length
187
Chain Sequence
GHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTALWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVILQCDSQVAFDGFSLCKEGHPQCLNSQPHARGSSRAIFSPSRRWWYRCYAYDSNSPYEWSLPSDLLELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human Leukocyte Antigen F Presents Peptides and Regulates Immunity through Interactions with NK Cell Receptors.
pubmed doi rcsb
molecule tags Protein binding
source organism Homo sapiens
molecule keywords cDNA FLJ39643 fis, clone SMINT2004023, highly similar to HLA
total genus 19
structure length 187
sequence length 195
ec nomenclature
pdb deposition date 2016-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...