The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
70
|
sequence length |
270
|
structure length |
253
|
Chain Sequence |
CGRTSCHLPRDVLTRACAYQDRRGQQRLPEWRDPDKYCPSYNKSPQSNSPVLLSRLHFEKDADSSERIIAPMRWGLVPSWFKESDPSKLQFNTTNCRSDTVMEKRSFKVPLGKGRRCVVLADGFYEWQRCQGTNQRQPYFIYFPQIEKVWDNWRLLTMAGIFDCWEPPEGGDVLYSYTIITVDSCKGLSDIHHRMPAILDGEEAVSKWLDFGEVSTQEALKLIHPTENITFHAVSSVVNNSRNNTPECLAPVA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal Structure of the SRAP Domain of Human HMCES Protein (CASP target)
rcsb |
| molecule tags |
Dna binding protein
|
| source organism |
Homo sapiens
|
| molecule keywords |
Embryonic stem cell-specific 5-hydroxymethylcytosine-binding
|
| total genus |
70
|
| structure length |
253
|
| sequence length |
270
|
| ec nomenclature |
ec
3.4.-.-: |
| pdb deposition date | 2016-06-29 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02586 | SRAP | SOS response associated peptidase (SRAP) |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Alpha-Beta Complex | hypothetical protein yedk fold | SOS response associated peptidase-like |
#chains in the Genus database with same CATH superfamily 5KO9 A; 2ICU A; 2F20 A; 2BDV A; 1ZN6 A; #chains in the Genus database with same CATH topology 2AEG A; 5KO9 A; 2ICU A; 2F20 A; 2BDV A; 1ZN6 A; #chains in the Genus database with same CATH homology 5KO9 A; 2ICU A; 2F20 A; 2BDV A; 1ZN6 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
