5KSQA

Stationary phase survival protein e (sure) from xylella fastidiosa
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
258
structure length
252
Chain Sequence
MRVLVSNDDGVDAPGIKILADALRNAGHEVMVVAPDRDRSGASNSLTLDTPIRAKQIDMHTYSVAGTPTDCVHLALTGLLNYDPDIVVSGINNTGNLGDDVIYSGTVSAAMEGRFLGLPAVAVSLVTLAPQYETAAHAAINIVAQLKTDPLPADTILNVNVPDVTWQQMRGFKVTRLGNRHRSAPCLTQTDPRGHTIYWIGPAGPEQDAGPGTDFDAVRNTYISITPIHVDLTRYQALENVTRWTDRLTAHM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational variability of the stationary phase survival protein E from Xylella fastidiosa revealed by X-ray crystallography, small-angle X-ray scattering studies, and normal mode analysis.
pubmed doi rcsb
molecule keywords 5'-nucleotidase SurE
molecule tags Hydrolase
source organism Xylella fastidiosa (strain 9a5c)
total genus 57
structure length 252
sequence length 258
chains with identical sequence B
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2016-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01975 SurE Survival protein SurE
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...