5LFLA

Mama rs-1 arstm double mutant
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
177
structure length
177
Chain Sequence
AMGDKAKLFRNISQRCLRRGSPEEALRFLKEWARHEKNDPEPLYQMGIALANLGDYQRAVTVFDKVLKLRPNHFMASYRKGAVLLKIKQYKLALPVLEAVVAAAPADARAYYLLGLAYDGDEQLEKGIEAMQKAVDLDPEEIKYHQHLGFMNVRKDDHKTAAEHFTKVMELERSQDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Differing self-assembling protein nanostructures in soluble and crystal form reveal dynamic behaviour
rcsb
molecule tags Protein binding
source organism Desulfovibrio magneticus (strain atcc 700980 / dsm 13731 / rs-1)
molecule keywords Magnetosome protein MamA
total genus 72
structure length 177
sequence length 177
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07719 TPR_2 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...