5MRCPP

Structure of the yeast mitochondrial ribosome - class a
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
119
structure length
116
Chain Sequence
TCGLVRIRLARFGRKNSPVYNIVVANSRKARDAKPIEVLGTYVPVPSPVTKRELKRGVVPIKDVKLDFDRTKYWIGVGAQPSETVTKLLRKAGILNDAWATSKNSRKVVFERMETL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the yeast mitochondrial ribosome.
pubmed doi rcsb
molecule keywords 21S ribosomal RNA
molecule tags Ribosome
total genus 19
structure length 116
sequence length 119
ec nomenclature
pdb deposition date 2016-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
PP PF00886 Ribosomal_S16 Ribosomal protein S16
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...