5MUKA

Glycoside hydrolase bt3686
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
409
structure length
375
Chain Sequence
QQKLVEVAKGYSLVTHGDEQYISYYDADGYLVLGKRKLNSKQWTLHRTQYRGHNIISIMVDGEGYLHVSFDHHGHKLNYCRSIAPGSLELGDKMPMTGVDEGNVTYPEFYPLTDGDLLFVYRSGSSGRGNLVMNRYSLKDHKWARVQDVLIDGEDKRNAYWQLYVDEKGTIHLSWVWRETWQVETNHDLCYARSFDNGVTWYKSDGEQYKLPITASNAEYACRIPQNSELINQTSMSADAGGNPYIATYWRSSDSEVPQYRIVWNDGKTWHNRQVTDRKTPFTLKMIPVARPRIVVEDGEIFYIFRDEERGSRVSMAHTADVANGKWIVTDLTDFSVDAWEPSHDTELWKKQRKLNLFVQHTCPQMIYVLEANTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Neuraminidase
publication title Unusual active site location and catalytic apparatus in a glycoside hydrolase family.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron (strain atcc 29148 / dsm 2079 / nctc 10582 / e50 /
total genus 99
structure length 375
sequence length 409
ec nomenclature
pdb deposition date 2017-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15892 BNR_4 BNR repeat-containing family member
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...