5N61Q

Rna polymerase i initially transcribing complex
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
512
structure length
389
Chain Sequence
TFIRGPICGTDNCPSRLWRIIDGRRTCQYGHVMKLIGHEAKLLFLKSFQFILKRQIRWLITEMRFPKEFEHVAKIIWLKILKTINDQPQEELKLQLHMTSTISILYLASTHLSLPVYTCDYIKWICTAKMPYFQASEILQLYNKIALTCGMIHFKEFFNSEISCQGLLLKLVMQCALPPEFYFYTKQVIEFEETDIRNLTLWERTDERHTGRVSNHAELRVLSYFMLTINWMLSFDRDRQYPLKWILSLTESLTQRTTTSESIGRNIVKVVYPDKPTSSDYFQWSEEETLEFLKWMEKQFLPTQTDQKIARRKLYKIFPLDSTHQLTFIEDLQERYAKQTPFFPPARKEAIGRLLTHIASQLLVDFAISKEQLKDCISRIKNACLHRMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of RNA Polymerase I Transcription Initiation.
pubmed doi rcsb
molecule tags Transferase
source organism Saccharomyces cerevisiae
molecule keywords DNA-directed RNA polymerase I subunit RPA190
total genus 109
structure length 389
sequence length 512
ec nomenclature
pdb deposition date 2017-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF11781 zf-RRN7 Zinc-finger of RNA-polymerase I-specific TFIIB, Rrn7
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...