5N61R

Rna polymerase i initially transcribing complex
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
440
structure length
303
Chain Sequence
MFEVPITLTNRKFAQRRKLKYQYINYISRRFDRISKQQKKRRRERHWRSVSFEIWRTVSSQNKQPINKQKMTYHNFKKIEKIPLRKMEIPLLHCTKENKLYFQSISRGLEPLKTSTSEVRNYRTRHIVTLTDLLHLNVSRHNWSLAYKIFATLIRIPGVQIKSLWGIGVEILDNLSNSSSGLDFLQWMCQIYSSKSRSIVPPFQTGSRTHTAKFAITYLWSSLINCQKSMLIDKISEWVLTPPFMEDAEVWFIYASCHLLKADINQVIKHIHYVRTFLKICLDKGGFAVPSRLIENQLKSFES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of RNA Polymerase I Transcription Initiation.
pubmed doi rcsb
molecule tags Transferase
source organism Saccharomyces cerevisiae
molecule keywords DNA-directed RNA polymerase I subunit RPA190
total genus 81
structure length 303
sequence length 440
ec nomenclature
pdb deposition date 2017-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF04090 RNA_pol_I_TF RNA polymerase I specific initiation factor
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...