5NKZA

Crystal structure of h. polymorpha ubiquitin conjugating enzyme pex4p in complex with soluble domain of pex22p
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
182
structure length
182
Chain Sequence
ASTEKRLLKEYRAVKKELTEKRSPIHDTGIVDLHPLEDGLFRWSAVIRGPDQSPFEDALWKLEIDIPTNYPLDPPKIKFVVFGEEKIRQLQRKTSSGARKVCYKMPHPNVNFKTGEICLDILQQKWSPAWTLQSALVAIVVLLANPEPLSPLNIDMANLLKCDDTTAYKDLVHYYIAKYSAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into K48-linked ubiquitin chain formation by the Pex4p-Pex22p complex.
pubmed doi rcsb
molecule keywords Ubiquitin-conjugating enzyme E2-21 kDa
molecule tags Transferase
source organism Pichia angusta
total genus 54
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.3.2.23: E2 ubiquitin-conjugating enzyme.
pdb deposition date 2017-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00179 UQ_con Ubiquitin-conjugating enzyme
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...