5NQ9A

Crystal structure of laccases from pycnoporus sanguineus, izoform ii, monoclinic
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
497
structure length
497
Chain Sequence
AIGPVADLTLTNAAVSPDGFSREAVVVNGVTPAPLISGQKGDRFQLNVIDNLTNHTMLKTTSIHWHGFFQHGTNWADGPAFVNQCPIASGHSFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPNDPQASLYDIDNDDTVITLADWYHVAAKLGPRFPPGSDATLINGLGRSPGTTAADLAVIKVTQGKRYRFRLVSLSCDPNHTFSIDGHTMTIIEADSVNTQPLEVDSIQIFAAQRYSFVLDASQPVDNYWIRANPSFGNTGFAGGINSAILRYLGAPEIEPTTTQTTPTKPLTEVDLHPLTPMAVPGRPEPGGVDKPLNMVFNFNGTNFFINNHSFVPPSVPVLLQILSGAQAAQDLVPEGSVYVLPSNSSIEISFPATVNAPGAPHPFHLHGHTFAVVRSAGSSEYNYDNPIFRDVVSTGTPGDNVTIRFQTANPGPWFLHCHIDFHLDAGFAVVMAEDTPDTTAANPVPQAWSDLCPIYDALDPSDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural studies of two thermostable laccases from the white-rot fungus Pycnoporus sanguineus.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Laccase, izoform II
total genus 142
structure length 497
sequence length 497
chains with identical sequence C
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2017-04-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...