5O0WA

Crystal structure of the complex between nb474 and trypanosoma congolense fructose-1,6-bisphosphate aldolase
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
360
structure length
360
Chain Sequence
SRRVEVLLTQLPAYNRLKTPYEEELIETAKKMTAPGKGLLAADESTGSCSKRFAGIGLSNTAEHRRQYRALMLECAGFEQYISGVILHDETVYQRASTGETFPQLLRRRGVVPGIKTDCGLEPLVEGADGEQMTAGLDGYVKRAKKYYAVGCRFCKWRNVYKIQNGTVSEAVVRFNAETLARYAVLSQLCGLVPIVEPEVMIDGTHDIETCQRVSQHVWAEVVSALHRHGVVWEGCLLKPNMVVPGAESGQTATAEQVAEYTVKTLARVLPPALPGVTFLSGGLSEVMASEYLNAMNNSPLPRPWKLTFSYARALQSSAIKAWGGKSSGVAAGRRAFMHRAKMNSLAQLGRYNRGDDDKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the high specificity of a Trypanosoma congolense immunoassay targeting glycosomal aldolase.
pubmed doi rcsb
molecule tags Lyase
source organism Trypanosoma congolense (strain il3000)
molecule keywords Fructose-bisphosphate aldolase
total genus 141
structure length 360
sequence length 360
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2017-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00274 Glycolytic Fructose-bisphosphate aldolase class-I
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...