5O63A

Crystal structure of ubalai restriction endonuclease b3 domain domain (mutant l24m l53m l95m) with cognate dna
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
159
structure length
159
Chain Sequence
NELIKYAKELVRSAGKTLKSAAMFAKVLTPNDDSGRHGVLVPTEAYSFFPDMPISDPSQNATSNFPAFDSLSKTHKTLAYKYYERYPERRITRMHGLLNERNYDPRLTIFLFARHTDGSSGYYFDCANSGSGGRFEVLFALCFGEAISPKAGLFVVRPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Restriction endonuclease UbaLAI
publication title UbaLAI is a monomeric Type IIE restriction enzyme.
pubmed doi rcsb
source organism Unidentified
total genus 46
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 3.1.21.4: Type II site-specific deoxyribonuclease.
pdb deposition date 2017-06-05
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...