5OPTd

Structure of ksrp in context of trypanosoma cruzi 40s
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
223
structure length
223
Chain Sequence
KEEWVPCTKLGRLVKEQKITSLEEIFLFSMPIKEHQIVDQLIKESDMRDELMLIVPVQKATSAGQRTRFKAFNIVGDGNGHIGVGARVGKEVSLAIRASMIAAKLNVVPIRRGYWGNKIGEPHTIPMKVTGKCGSVSVRLIPAPRGAGIVAAPVPKKILEFAGVEDVYTSSCGNTRTRGNFIMATFYALRKTYGFLTPDLWAETEVSRDPTDEHSDFLTMGSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords Activated protein kinase C receptor, putative
publication title The cryo-EM Structure of a Novel 40S Kinetoplastid-Specific Ribosomal Protein.
pubmed doi rcsb
source organism Trypanosoma cruzi (strain cl brener)
total genus 40
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2017-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
d PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
d PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...