5SELA

Crystal structure of human phosphodiesterase 10 in complex with 4-(azetidine-1-carbonyl)-2-methyl-n-(2-methyl-5-pyridin-2-ylpyrazol-3-yl)pyrazole-3-carboxamide
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
313
structure length
312
Chain Sequence
GLMQFTLPVRLCKEIELFHFDIGPFENMWPGIFVYMVHRSCGTSCFELEKLRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNHTLFTDLERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEGHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLNNQSHRDRVIGLMMTACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKDEVPQGQLGFYNAVAIPCYTTLTQILPPTEPLLKACRDNLSQWEKVIRGEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A high quality, industrial data set for binding affinity prediction: performance comparison in different early drug discovery scenarios.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
molecule keywords cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
total genus 126
structure length 312
sequence length 313
chains with identical sequence B, C, D
ec nomenclature ec 3.1.4.17: 3',5'-cyclic-nucleotide phosphodiesterase.
pdb deposition date 2022-01-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...