5SVAV

Mediator-rna polymerase ii pre-initiation complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
85
structure length
85
Chain Sequence
FIPHIFYSLHQIRKDPNNLSNQLETLTGSIRHRLKLCKSLISENEDTKDLLSKSPSEWQDIIHQREQELQIKRDVLDDLYRKLQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
pubmed doi rcsb
molecule tags Transcription, transferase/dna
source organism Saccharomyces cerevisiae
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 32
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2016-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF07544 Med9 RNA polymerase II transcription mediator complex subunit 9
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...