5SVAd

Mediator-rna polymerase ii pre-initiation complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
285
structure length
116
Chain Sequence
SNAEASRVYEIIVESVVNEVREDFENAGIDEQTLQDLKNIWQKKLTETKVTTFSWDNQFNDYLISEDGPDENLMLCLYDKVTRTKARWKCSLKDGVVTINRNDYTFQKAQVEAEWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
pubmed doi rcsb
molecule tags Transcription, transferase/dna
source organism Saccharomyces cerevisiae
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 35
structure length 116
sequence length 285
ec nomenclature
pdb deposition date 2016-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
d PF03153 TFIIA Transcription factor IIA, alpha/beta subunit
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...