5T5Hk

Structure and assembly model for the trypanosoma cruzi 60s ribosomal subunit
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
120
structure length
113
Chain Sequence
IRDLRDKSKDELLKQLMEFKKELSQLRVAQQLGRIRLIRKSIARILTVLNRNQRESLRKVYAGRRLRLAMPKALRPKLTRRRRLALKDNEKNRKTRRQLRMARKFPRRVYAVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords RNA LARGE SUBUNIT ALPHA
publication title Structure and assembly model for the Trypanosoma cruzi 60S ribosomal subunit.
pubmed doi rcsb
total genus 29
structure length 113
sequence length 120
ec nomenclature
pdb deposition date 2016-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
k PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...