5TDBA

Crystal structure of the human ubr-box domain from ubr2 in complex with asymmetrically double methylated arginine peptide
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
70
structure length
70
Chain Sequence
LCGRVFKVGEPTYSCRDCAVDPTCVLCMECFLGSIHRDHRYRMTTSGGGGFCDCGDTEAWKEGPYCQKHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Bound Waters Mediate Binding of Diverse Substrates to a Ubiquitin Ligase.
pubmed doi rcsb
molecule tags Ligase
source organism Homo sapiens
molecule keywords E3 ubiquitin-protein ligase UBR2
total genus 18
structure length 70
sequence length 70
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02207 zf-UBR Putative zinc finger in N-recognin (UBR box)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...