5TFVA

Crystal structure of mt-i isolated from bothrops asper venom.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
122
structure length
122
Chain Sequence
SLIEFAKMILEETKRLPFPYYTTYGCYCGWGGQGQPKDATDRCCFVHDCCYGKLSNCKPKTDRYSYSRKSGVIICGEGTPCEKQICECDKAAAVCFRENLRTYKKRYMAYPDVLCKKPAEKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a phospholipase A2 from Bothrops asper venom: Insights into a new putative "myotoxic cluster".
pubmed doi rcsb
molecule keywords Basic phospholipase A2 myotoxin III
molecule tags Toxin
total genus 39
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature ec 3.1.1.4: Phospholipase A(2).
pdb deposition date 2016-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00068 Phospholip_A2_1 Phospholipase A2
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...