5THPB

Rhodocetin in complex with the integrin alpha2-a domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
122
structure length
119
Chain Sequence
CPLHWYNGYCYRVFSELKTWEDAESFCYAQHKGSRLASIHREEEAFVGKLASQTLKYTSMWLGLNNPWKECKWEWSDDAKLDYKVWLRRPYCAVMVVKTDRIFWFNRGCEKTVSFVCKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Snaclec rhodocetin subunit gamma
publication title Dramatic and concerted conformational changes enable rhodocetin to block alpha 2 beta 1 integrin selectively.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 119
sequence length 122
chains with identical sequence E, H, K, N, Q
ec nomenclature
pdb deposition date 2016-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00059 Lectin_C Lectin C-type domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...