5TZ0A

Structure of the fremyella diplosiphon fluorescence recovery protein
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
102
structure length
102
Chain Sequence
SWSDLEQEVAQAAFQKAYEREINALIQDVRDNAVQISELEDIWRLHNFLSAKRHEIDGKYDYNYSVLVFVFATLIKQGWLHLDELKGLDQDKLTKIGSLSRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Additional families of orange carotenoid proteins in the photoprotective system of cyanobacteria.
pubmed doi rcsb
molecule tags Protein binding
source organism Tolypothrix sp. pcc 7601
molecule keywords Fluorescence Recovery Protein
total genus 38
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18032 FRP Photoprotection regulator fluorescence recovery protein
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...