5UK8B

The co-structure of (r)-4-(6-(1-(cyclopropylsulfonyl)cyclopropyl)-2-(1h-indol-4-yl)pyrimidin-4-yl)-3-methylmorpholine and a rationally designed pi3k-alpha mutant that mimics atr
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
267
structure length
244
Chain Sequence
MSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTGDYTLTLRKGGNNKLIKIFHRDFSDPLTFSSVVELINHYRVKLLYPVSKYQQKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Rationally Designed PI3K alpha Mutants to Mimic ATR and Their Use to Understand Binding Specificity of ATR Inhibitors.
pubmed doi rcsb
molecule tags Transferase/signaling protein/inhibitor
source organism Homo sapiens
molecule keywords Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic sub
total genus 95
structure length 244
sequence length 267
ec nomenclature
pdb deposition date 2017-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...