5ULHC

Structure of rnf165 in complex with a ubch5b~ub conjugate
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
51
structure length
51
Chain Sequence
DTDEKCTICLSMLEDGEDVRRLPCAHLFHQLCVDQWLAMSKKCPICRVDIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of new non-covalent ubiquitin binding sites on UbcH5
rcsb
molecule tags Transferase
source organism Homo sapiens
molecule keywords Ubiquitin-conjugating enzyme E2 D2
total genus 7
structure length 51
sequence length 51
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2017-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...