5USFC

Leishmania donovani tyrosyl-trna synthetase in complex with nanobody and inhibitor
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
QVQLQESGGGLVLPGGSLRLSCATSGFTFSNSWMYWVRQAPGKGLEWVSRINAGGNTVDYKDSVKGRFSISRDNAKNTLYLQMNSLKPEDTAVYYCARGLNRYAYDSRGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Leishmania donovani tyrosyl-tRNA synthetase structure in complex with a tyrosyl adenylate analog and comparisons with human and protozoan counterparts.
pubmed doi rcsb
molecule tags Ligase/ligase inhibitor
source organism Leishmania donovani (strain bpk282a1)
molecule keywords Tyrosyl-tRNA synthetase, putative
total genus 29
structure length 118
sequence length 118
chains with identical sequence D
ec nomenclature
pdb deposition date 2017-02-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...