5V1UA

Tbib1 in complex with the tbia(beta) leader peptide
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
84
structure length
84
Chain Sequence
MKISDAVVSAHIDDEVVLLHLQTGTYFGLDAVGSRIWSLLEEGKRPEEIVDAICAEYSVDRPTVERDLRDFLRALANKELLEGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Steric Complementarity Directs Sequence Promiscuous Leader Binding in Lasso Peptide Biosynthesis
rcsb
molecule tags Protein binding
source organism Thermobaculum terrenum (strain atcc baa-798 / ynp1)
molecule keywords TbiB1
total genus 26
structure length 84
sequence length 84
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2017-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05402 PqqD Coenzyme PQQ synthesis protein D (PqqD)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...