5V2CX

Re-refinement of crystal structure of photosystem ii complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
40
structure length
40
Chain Sequence
MTITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKVQRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
publication title Chlorophyll a with a farnesyl tail in thermophilic cyanobacteria.
pubmed doi rcsb
total genus 13
structure length 40
sequence length 40
chains with identical sequence x
ec nomenclature
pdb deposition date 2017-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF06596 PsbX Photosystem II reaction centre X protein (PsbX)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...