The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
142
|
sequence length |
437
|
structure length |
422
|
Chain Sequence |
SPEEQLLFLYIIYTVGYALSFSALVIASAILLGFRHLHCTRNYIHLNLFASFILRALCVFFKDAALKWLSYQDSLACRLVFLLQYCVAANYYWLLVEGVYLYTLLAFNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYSEQWIFRLYVAIGWGVPLLFVVPWGIVKYLYEDEGCWTRNSNMNYWLIIRLPILFACIVNFLIFVRVICIVVSKLKANLMCKTDIAFRLAKSTLTLIPLLCTHEVIFAFVMDRFIKLFTELSFTSFQGLMVAILYCFVNNEVQLEFRKSWERWRL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Human GLP-1 receptor transmembrane domain structure in complex with allosteric modulators.
pubmed doi rcsb |
| molecule tags |
Signaling protein
|
| source organism |
Homo sapiens
|
| molecule keywords |
Glucagon-like peptide 1 receptor, Endolysin chimera
|
| total genus |
142
|
| structure length |
422
|
| sequence length |
437
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
3.2.1.17: Lysozyme. |
| pdb deposition date | 2017-04-05 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00959 | Phage_lysozyme | Phage lysozyme |
| A | PF00002 | 7tm_2 | 7 transmembrane receptor (Secretin family) |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
