5VH1A

Crystal structure of chicken gamma s crystallin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
177
structure length
177
Chain Sequence
SRAGPKVTFYEDKNFLGRRYECDADCPDFHTYLNRCNSIRVEGGTWVAYERPNYSGNMYVLRRGEYPDYHHWMGLNDRLGSCKAVHIPSGAQGHIQVFEKGDFGGQMFEATEDCPSILEECHFREVHACRVLEGIWVFYEHPNYRGRQYLLPKGEYRQPVEWGAVTPAVQSFRSIAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Chicken gamma S-Crystallin Reveals Lattice Contacts with Implications for Function in the Lens and the Evolution of the beta gamma-Crystallins.
pubmed doi rcsb
molecule tags Protein binding
source organism Gallus gallus
molecule keywords Gamma S-crystallin
total genus 42
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2017-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00030 Crystall Beta/Gamma crystallin
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...