5VS5B

Aba-mimicking ligand amf2alpha in complex with aba receptor pyl2 and pp2c hab1
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
321
structure length
296
Chain Sequence
CIPLWGTVSIQGNRSEMEDAFAVSPHFLKLPIKMHLTGHFFGVYDGHGGHKVADYCRDRLHFALAEEIERIKRQVQWDKVFTSCFLTVDGEIEGKIGRAVVSSDKVLEAVASETVGSTAVVALVCSSHIVVSNCGDSRAVLFRGKEAMPLSVDHKPDREDEYARIENAGGKVIQWQGARVFGVLAMSRSIGDRYLKPYVIPEPEVTFMPRSREDECLILASDGLWDVMNNQEVCEIARRRILMWHKKNGAPPLAERGKGIDPACQAAADYLSMLALQKGSKDNISIIVIDLKAQRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combining chemical and genetic approaches to increase drought resistance in plants.
pubmed doi rcsb
molecule tags Hydrolase
source organism Arabidopsis thaliana
molecule keywords Abscisic acid receptor PYL2
total genus 87
structure length 296
sequence length 321
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2017-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00481 PP2C Protein phosphatase 2C
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...