5VYCf1

Crystal structure of the human 40s ribosomal subunit in complex with denr-mct-1.
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
72
structure length
72
Chain Sequence
KKRKKKSCTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Human Ribosome in Complex with DENR-MCT-1.
pubmed doi rcsb
molecule keywords 40S ribosomal protein S19
molecule tags Ribosome
source organism Homo sapiens
total genus 5
structure length 72
sequence length 72
chains with identical sequence f2, f3, f4, f5, f6
ec nomenclature
pdb deposition date 2017-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f1 PF00240 ubiquitin Ubiquitin family
f1 PF01599 Ribosomal_S27 Ribosomal protein S27a
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...